2. Metabolic Disease

Metabolic Disease

Metabolic Disease

Related Products

PDF 53.7 MB

Metabolic diseases is defined by a constellation of interconnected physiological, biochemical, clinical, and metabolic factors that directly increases the risk of cardiovascular disease, type 2 diabetes mellitus, and all cause mortality. Associated conditions include hyperuricemia, fatty liver (especially in concurrent obesity) progressing to nonalcoholic fatty liver disease, polycystic ovarian syndrome (in women), erectile dysfunction (in men), and acanthosis nigricans. Metabolic disease modeling is an essential component of biomedical research and a mandatory prerequisite for the treatment of human disease. Somatic genome editing using CRISPR/Cas9 might be used to establish novel metabolic disease models.

Cat. No. Product Name CAS No. Purity Chemical Structure
  • HY-P1223
    Exendin-3/4 (59-86) 1263874-37-8 98.19%
    Exendin-3/4 (59-86) is a Exendin-4 peptide derivative.
    Exendin-3/4 (59-86)
  • HY-P1224
    HAEGTFTSDVS 864915-61-7 98.62%
    HAEGTFTSDVS is the first N-terminal 1-11 residues of GLP-1 peptide.
    HAEGTFTSDVS
  • HY-P1225
    {Val1}-Exendin-3/4 99.45%
    {Val1}-Exendin-3/4 is the first N-terminal 1-28 residues of Exendin-4 peptide.
    {Val1}-Exendin-3/4
  • HY-P1226
    HAEGTFTSD 926018-45-3 98.48%
    HAEGTFTSD is a 9-residue peptide of human GLP-1 peptide or GLP-1(7-36), amide (HY-P0054A). GLP-1(7-36), amide is a physiological incretin hormone that stimulates insulin secretionin a glucose-dependant manner
    HAEGTFTSD
  • HY-P1227
    SDV-Exendin-3/4
    SDV-Exendin-3/4 is a 32-amino acid peptide.
    SDV-Exendin-3/4
  • HY-P1229
    FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS 98.01%
    FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.
    FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
  • HY-P1230
    HAEGT 852155-81-8 98.86%
    HAEGT is the first N-terminal 1-5 residues of glucagon like peptide-1 (GLP-1) peptide, and the sequence is His-Ala-Glu-Gly-Thr. HAEGT acts as a competitive substrate for probing prime substrate binding sites of human dipeptidyl peptidase-IV (DPP-IV) 1, in which the N-terminal His-Ala is catalyzed cleavage by DPP-IV. HAEGT can be used in the research of diabetes, obesity.
    HAEGT
  • HY-P1231
    GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS 99.03%
    GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.
    GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
  • HY-P1232
    HAE 64111-99-5 99.94%
    HAE is a 3-amino acid peptide which consists of histidine, alanine and glutamate.
    HAE
  • HY-P1401
    Protein Kinase C (19-36) 113731-96-7 99.14%
    Protein Kinase C (19-36) is a pseudosubstrate peptide inhibitor of protein kinase C (PKC), with an IC50 of 0.18 μM. Protein Kinase C (19-36) markedly attenuated vascular hyperproliferation and hypertrophy as well as glucose-induced suppression of natriuretic peptide receptor response.
    Protein Kinase C (19-36)
  • HY-P1503
    ACTH (4-11) 67224-41-3 98.48%
    ACTH (4-11), an adrenocorticotropin hormone fragment, possesses a weak α-melanocyte stimulating hormone (α-MSH) potency only at high doses (100 and 1000 nM).
    ACTH (4-11)
  • HY-P1518
    Adrenocorticotropic Hormone (ACTH) (1-10), human 2791-05-1 98.26%
    Adrenocorticotropic Hormone (ACTH) (1-10), human, an adrenocorticotropin hormone fragment, possesses a weak α-melanocyte stimulating hormone (α-MSH) potency only at high doses (100 and 1000 nM).
    Adrenocorticotropic Hormone (ACTH) (1-10), human
  • HY-P1541
    Motilin, canine 85490-53-5 98.63%
    Motilin, canine is a 22-amino acid peptide. Motilin is a potent agonist for gastrointestinal smooth muscle contraction.
    Motilin, canine
  • HY-P1955
    Etelcalcetide 1262780-97-1 98%
    Etelcalcetide (AMG 416; KAI-4169) is a synthetic calcimimetic as an activator of the calcium sensing receptor (CaSR). Etelcalcetide is effective in lowering parathyroid hormone (PTH) concentrations in patients receiving dialysis with secondary hyperparathyroidism receiving hemodialysis, which is promising for research in the field of secondary hyperparathyroidism and chronic kidney disease.
    Etelcalcetide
  • HY-P2168
    Demoxytocin 113-78-0 98.34%
    Demoxytocin is a heterologous cyclic peptide and an analog of Oxytocin (HY-17571). Demoxytocin affects the permeability of cell membranes and increases calcium ion levels in smooth muscle cells, thereby enhancing the contraction of smooth muscle cells. Demoxytocin also stimulates the contraction of uterine smooth muscle. Demoxytocin possesses the functions of oxytocin. Demoxytocin can be used to study labor stimulation in preterm premature rupture of membranes.
    Demoxytocin
  • HY-P2281
    Atrial natriuretic factor (1-28) (human, porcine) 91917-63-4 98%
    Atrial natriuretic factor (1-28) (human, porcine) exhibits blood pressure lowering activity by increasing sodium and urine excretion. Atrial natriuretic factor (1-28) (human, porcine) inhibits the release of pituitary adrenocorticotropic hormone (ACTH) and beta-endorphin through inhibition of pro-opiomelanocortin (POMC) expression. Atrial natriuretic factor (1-28) (human, porcine) increases cGMP levels in RMIC cells with an IC50 of 1.2 nM.
    Atrial natriuretic factor (1-28) (human, porcine)
  • HY-P2325
    Exoenzyme C3, clostridium botulinum 58319-92-9
    Exoenzyme C3, clostridium botulinum, is a mono-ADP-ribosylating enzyme. Exoenzyme C3, clostridium botulinum specifically modifies RhoA, B, and C by transferring ADP-ribose to them, thereby inactivating these GTPases. Exoenzyme C3, clostridium botulinum can induce neuronal axonal and dendritic growth, inhibit macrophage migration, and regulate cytoskeletal dynamics. Exoenzyme C3, clostridium botulinum can be used in the research of spinal cord injury and diabetic painful neuropathy.
    Exoenzyme C3, clostridium botulinum
  • HY-P2510
    Parathyroid Hormone (1-34), human, biotinylated 99.49%
    Parathyroid Hormone (1-34), human, biotinylated is a probe for the parathyroid hormone receptor, can be used for analyzing the interaction between parathyroid hormone and parathyroid hormone receptors in living cells and for purifying hormone-receptor complexes with affinity columns.
    Parathyroid Hormone (1-34), human, biotinylated
  • HY-P2588
    Osteocalcin (human) 136461-80-8
    Osteocalcin (Osteocalcin (1-49)) (human) is a vitamin K-dependent bone specific protein. Osteocalcin (human) is chemotactic for several of the cell types frequently found at bone remodeling surfaces.
    Osteocalcin (human)
  • HY-P2636
    Cholecystokinin Precursor (24-32) (rat) 99291-20-0 99.54%
    Cholecystokinin Precursor (24-32) (rat) is a cholecystokinin precursor that can be expressed in the heart, lungs, and kidneys as well as in the gastrointestinal tract and brain. Cholecystokinin is a brain-gut peptide that stimulates gallbladder contraction and pancreatic exocrine secretion and also acts as a neurotransmitter.
    Cholecystokinin Precursor (24-32) (rat)
Cat. No. Product Name / Synonyms Application Reactivity